PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.D02423.1.p
Common NameMIMGU_mgv1a008377mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family NAC
Protein Properties Length: 387aa    MW: 43733.9 Da    PI: 5.0648
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.D02423.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.41.4e-49341591127
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                       l pGfrF+Ptdeel+++yLkkk+ g + e+ evi+evdi+++ePwdLp ++v ++++ew+fFs+r +ky++g++++rat+ gyWkatgk++ v
  Migut.D02423.1.p  34 LFPGFRFSPTDEELIQYYLKKKLLGFDEEV-EVIPEVDICRHEPWDLPaQAVIESDNEWFFFSPRGRKYPNGSQSKRATEFGYWKATGKERGV 125
                       579************************888.99***************667777899************************************ PP

               NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyr 127
                       +s +++l+g+k+tLvf++grapkg++t+W+mhey 
  Migut.D02423.1.p 126 KS-GSNLIGTKRTLVFHTGRAPKGQRTEWIMHEYC 159
                       **.9******************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.09E-5527175IPR003441NAC domain
PROSITE profilePS5100553.85934176IPR003441NAC domain
PfamPF023652.3E-2536159IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009626Biological Processplant-type hypersensitive response
GO:0009910Biological Processnegative regulation of flower development
GO:0034976Biological Processresponse to endoplasmic reticulum stress
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MGADNEAELV TFPVSRNAGN NISMEISLAE ASSLFPGFRF SPTDEELIQY YLKKKLLGFD  60
EEVEVIPEVD ICRHEPWDLP AQAVIESDNE WFFFSPRGRK YPNGSQSKRA TEFGYWKATG  120
KERGVKSGSN LIGTKRTLVF HTGRAPKGQR TEWIMHEYCT SEKSDDAMVV CRLRKNRDFH  180
LNDDNARRNS PGDRDLDLAE VNLSSGEQIG MLEGAKECSS SYNSHSVEQV DNGSESDDKI  240
TKGSSESSHN KGYDKEEDCY ADIMKDDIIK LDEDSSLIEN AVPLRVVTLK QKSEMKSNQP  300
STEASVSSQG TANRRLRLRN QRVESYQPEN FEIHKFSAKD IPIEDSLDFG ARTRRGSLSL  360
FAVLVVLILL ILIFFFTRDF WLKIIP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-433317716166NAC domain-containing protein 19
4dul_A2e-433317716166NAC domain-containing protein 19
1ut7_B2e-433317716166NO APICAL MERISTEM PROTEIN
1ut7_A2e-433317716166NO APICAL MERISTEM PROTEIN
1ut4_B2e-433317716166NO APICAL MERISTEM PROTEIN
1ut4_A2e-433317716166NO APICAL MERISTEM PROTEIN
3swp_D2e-433317719169NAC domain-containing protein 19
3swp_C2e-433317719169NAC domain-containing protein 19
3swp_B2e-433317719169NAC domain-containing protein 19
3swp_A2e-433317719169NAC domain-containing protein 19
3swm_D2e-433317719169NAC domain-containing protein 19
3swm_C2e-433317719169NAC domain-containing protein 19
3swm_B2e-433317719169NAC domain-containing protein 19
3swm_A2e-433317719169NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012850367.10.0PREDICTED: NAC domain-containing protein 89-like
RefseqXP_012850368.10.0PREDICTED: NAC domain-containing protein 89-like
SwissprotQ94F586e-85NAC89_ARATH; NAC domain-containing protein 89
TrEMBLA0A022QFK10.0A0A022QFK1_ERYGU; Uncharacterized protein
STRINGSolyc06g074170.2.11e-121(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41542243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22290.15e-79NAC domain containing protein 89